PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_47991
Common NameKK1_049437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 412aa    MW: 45669 Da    PI: 6.0469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_47991genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l  +++++G g+W++ +++ g+ R++k+c++rw +yl
    C.cajan_47991 14 KGPWTPEEDQKLMAYIEEFGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding513.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia+ ++ +Rt++++k++w+++l
    C.cajan_47991  67 RGKFSLQEEQTIIQLHALLGNR-WSAIAAQLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.206961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007178.3E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001671.13E-101661No hitNo description
PROSITE profilePS5129425.2962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2665116IPR009057Homeodomain-like
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.99E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGPWTPE EDQKLMAYIE EFGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIAAQLPKRT DNEIKNYWNT HLKKRLTRMG  120
IDPTTHKPKS DALGGSAGGG CHSKDAANLS HMAQWESARL EAEARLVRES KLQVQNNLGS  180
CSNATQPARL VLNKITTHQP SLPPCLDILK AWQSSWSKPQ PTTKDHNNTK MMHAMYAMML  240
STDDTLESPT STLCFPGTTT TATTTTTTVL PVPHNNIGVL FNENNNMLND AATMLHLQDD  300
DIMAAVEAFT SSTTGYNDEH DNDNDNDNNN NNNVIVVPPT LSNSVVLEGL NGNDNNALVY  360
DSNDNLGTEE ENMAMINGDG SLCNVNLDEN NKHYWNNIFN LVNDTLSDSS VF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158642.10.0hypothetical protein PHAVU_002G170000g
TrEMBLA0A151UDA70.0A0A151UDA7_CAJCA; Transcription factor MYB39
STRINGGLYMA20G04240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-104myb domain protein 16